PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.111910.1
Common NameCsa_1G025960, LOC101207158, WRKY2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 577aa    MW: 63339.5 Da    PI: 8.4284
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.111910.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.61.2e-33233290260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Cucsa.111910.1 233 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 290
                     8****************************************.***************85 PP

2WRKY105.52.7e-33407465159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  Cucsa.111910.1 407 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHD 465
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.6E-29223291IPR003657WRKY domain
SuperFamilySSF1182902.35E-25231291IPR003657WRKY domain
SMARTSM007748.6E-37232290IPR003657WRKY domain
PROSITE profilePS5081123.824233291IPR003657WRKY domain
PfamPF031061.4E-25233289IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37392467IPR003657WRKY domain
SuperFamilySSF1182902.48E-29399467IPR003657WRKY domain
PROSITE profilePS5081138.377402467IPR003657WRKY domain
SMARTSM007743.1E-39407466IPR003657WRKY domain
PfamPF031069.3E-26408465IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MASSSGSLDT SANSHPSFTF STHPFMTSSY SDLLASANID PPSSAPLRAS TTGVPKFKSL  60
PPPSLPLSPP PMSPSSFFAI PPGLSPAELL DSPVLLSASH VLPSPTTGTF PSHSLNWKSN  120
FGYNQQNIKE ENKYSSNFSF QTQSSKLPPT SFQPSSTIAP TTQGWSFQEQ RKKEDSFSSE  180
KNMVKPEFGS MRSFSPEYGV VQNQSQNNGS GELRSDYGNN YPQQSQTVNR RSDDGYNWRK  240
YGQKQVKGSE NPRSYYKCTF PNCPTKKKVE RSLDGQITEI VYKGSHNHPK PQSTRRSSLS  300
SAGSSQAIVA LNQAANEMAD QSFTTQGSGQ FDGVATPENS SISIGDEDFD RSSQKSKSGG  360
DDFDEEEPEA KRWRREGDNN EGISAAGSRT VREPRVVVQT TSDIDILDDG YRWRKYGQKV  420
VKGNPNPRSY YKCTNPGCPV RKHVERASHD LRAVITTYEG KHNHDVPPAR GSGSHSLSRP  480
FPNNEPPAAI RPLSVVTHHS NNGGHPQGLR LQRSSDSQAA FTVEMVQNGN GFSFPEFGNS  540
MGMGSYMNQT QPNDNLFTRA KEEPRDHDMF IQSLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-37233467877Probable WRKY transcription factor 4
2lex_A4e-37233467877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8976130.0HQ897613.1 Cucumis sativus WRKYP2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267657.10.0uncharacterized protein LOC101207158
TrEMBLG0Z7340.0G0Z734_CUCSA; Uncharacterized protein
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-113WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]